Training, content, and community

Sign In  |  Join for free!  |  Choose your country or region United States
Current Search
Go

Search Results (1,336)

Sort by:   

Describe the appearance of Earth and the moon [LAB Activity]

The students will describe the appearance of the Earth and the moon. Students will understand that the shape o...

Subject: Science

Grade: Grade 3

Submitted by: Mr Fisher

Search terms: Appearance of EarthLABAppearance of MoonShout OutScienceRonald Fisher

New English File Intermediate, Lesson 3B [SMART Notebook lesson]

Handy support material to New English File Intermediate. Topic: Looks and Appearances

Subject: English as a Second Language

Grade: Grade 10Grade 11Grade 12Post-Secondary

Submitted by: Ms Allison

Search terms: AppearancesNew English File IntermediateLooks

Mirror [Image]

Subject: History

Grade: KindergartenGrade 1Grade 2Grade 3Grade 4Grade 5Grade 6Grade 7Grade 8Grade 9Grade 10Grade 11Grade 12

Describe It, HD [SMART Table activity pack]

These activities encourage students to use descriptive language to illustrate specific attributes of people, p...

Subject: English Language Arts

Grade: Grade 1

Publisher: DigiXL

Search terms: texturehearcolorillustratecreatefacecharacterobjectitemplacepersonlookscenesizeshapedescriptionfeeltouchpeopleappearancebelongsoundHDtastesmelldrawactthing

E1302778.galleryitem [Image]

Subject: Cross-curricularArt and DesignHealth and Physical Education

Grade: Pre-KindergartenGrade 1Grade 2Grade 3Grade 4Grade 5Grade 6Grade 7Grade 8Grade 9Grade 10Grade 11Grade 12Post-Secondary

Publisher: Edupics

Search terms: sportsballssportball

My Life From Egg to Chick [SMART Notebook lesson]

This lesson introduces students to the life cycle of chickens. It provides students with visual images and vid...

Subject: Science

Grade: KindergartenGrade 1Grade 2Grade 3

Search terms: Healthy, adult hens will lay an egg daily.Water at the bottom of the incubator creates humidity. This prevents the eggs from drying out.As the heart develops, blood vessels appear.

Grouping Animals [SMART Table activity pack]

These activities encourage students to describe the characteristics of animals verbally and through writing. T...

Subject: Science

Grade: Kindergarten

Publisher: DigiXL

Search terms: liveclassificationdifferenttalentcharacteristicgamesimilarsortinsectwaterfishreptilemammalappearancebaseballgroupbelongclassifyamphibiandifferencefairsizedescribelandcommonsimilarityobservesamebigwritehabitatbehaviorbirdplaysmall

Grouping Animals, HD [SMART Table activity pack]

These activities encourage students to describe the characteristics of animals verbally and through writing. T...

Subject: Science

Grade: Kindergarten

Publisher: DigiXL

Search terms: differencedifferentmammalobservesizesmallfishsortbehaviorfairlandwatergroupsimilaritysameclassifywritehabitatinsectcharacteristicappearancecommonplaydescribeclassificationbigbirdbelongbaseballHDreptiletalentlivesimilargameamphibian

Counting Terms, HD [SMART Table activity pack]

These activities encourage students to use ordinal terms to count objects, describe a sequence of events and d...

Subject: Mathematics

Grade: Pre-Kindergarten

Publisher: DigiXL

Search terms: firsthappenanimalnumberreelthirdOlympicsdescribeappearancerecipefriendclothingorderfilmcontestfourthcakemedaleventdirectorsecondfifthlinepodiumcompetitionstepbakedancewinphotographmoviesceneHDplacepicturecountordinal term

E1298386.galleryitem [Image]

Subject: Art and DesignHealth and Physical EducationCross-curricular

Grade: Pre-KindergartenGrade 1Grade 2Grade 3Grade 4Grade 5Grade 6Grade 7Grade 8Grade 9Grade 10Grade 11Grade 12Post-Secondary

Publisher: Edupics

Search terms: sport

Terms of Use

© Copyright 2012 SMART Technologies ULC All Rights Reserved | Privacy Policy

Choose your country or region

  1. Canada

    English|Français

  2. United States of America

    English

  3. Additional countries coming soon.

  1. Argentina

    Español

  2. Chile

    Español

  3. Colombia

    Español

  4. República Dominicana

    Español

  5. México

    Español

  6. Venezuela

    Español

  7. Brasil

    Português

  8. Peru

    En Desarrollo

  9. Additional countries coming soon.

  1. Belgique

    Français

  2. Česká republika

    Česky

  3. Danmark

    Dansk

  4. Deutschland

    Deutsch

  5. Ελλάδα

    Ελληνικά

  6. England

    English

  7. España

    Español

  8. France

    Français

  9. Ireland

    English

  10. ישראל

    עברית

  11. Italia

    Italiano

  12. Nederland

    Nederlands

  13. Norge

    Norsk

  14. Northern Ireland

    English

  15. Österreich

    Deutsch

  16. Россия

    Русский

  17. Polska

    Polski

  18. Schweiz | Suisse

    Deutsch|Français

  19. Scotland

    English

  20. Suomi

    Suomi

  21. Sverige

    Svenska

  22. Türkiye Cumhuriyeti

    Türkçe

  23. Wales

    English

  24. Україна

    Українська

  25. Additional countries coming soon.

  1. Algérie

    Français

  2. مصر

    العربية

  3. Gabon

    Français

  4. Maroc

    Français

  5. Nigeria

    Français

  6. Sénégal

    Français

  7. South Africa

    English

  8. Tunisie

    Français

  9. Additional countries coming soon.

  1. العربية السعودية

    العربية

  2. UAE|دولة الامارات العربية المتحدة

    English|العربية

  3. Additional countries coming soon.

  1. Australia

    English

  2. New Zealand

    English

  3. India

    English

  4. 中国

    简体中文

  5. 臺灣

    繁體中文

  6. Additional countries coming soon.