Training, content, and community

Sign In  |  Join for free!  |  Choose your country or region United States
Current Search

Search Results (1,349)

Sort by:   

Describe the appearance of Earth and the moon [LAB Activity]

The students will describe the appearance of the Earth and the moon. Students will understand that the shape o...

Subject: Science

Grade: Grade 3

Submitted by: Mr Fisher

Search terms: Appearance of EarthLABAppearance of MoonShout OutScienceRonald Fisher

New English File Intermediate, Lesson 3B [SMART Notebook lesson]

Handy support material to New English File Intermediate. Topic: Looks and Appearances

Subject: English as a Second Language

Grade: Grade 10Grade 11Grade 12Post-Secondary

Submitted by: Ms Allison

Search terms: AppearancesNew English File IntermediateLooks

Mirror [Image]

Subject: History

Grade: KindergartenGrade 1Grade 2Grade 3Grade 4Grade 5Grade 6Grade 7Grade 8Grade 9Grade 10Grade 11Grade 12

Describe It, HD [SMART Table activity pack]

These activities encourage students to use descriptive language to illustrate specific attributes of people, p...

Subject: English Language Arts

Grade: Grade 1

Publisher: DigiXL

Search terms: texturehearcolorillustratecreatefacecharacterobjectitemplacepersonlookscenesizeshapedescriptionfeeltouchpeopleappearancebelongsoundHDtastesmelldrawactthing

E1302778.galleryitem [Image]

Subject: Cross-curricularArt and DesignHealth and Physical Education

Grade: Pre-KindergartenGrade 1Grade 2Grade 3Grade 4Grade 5Grade 6Grade 7Grade 8Grade 9Grade 10Grade 11Grade 12Post-Secondary

Publisher: Edupics

Search terms: sportsballssportball

My Life From Egg to Chick [SMART Notebook lesson]

This lesson introduces students to the life cycle of chickens. It provides students with visual images and vid...

Subject: Science

Grade: KindergartenGrade 1Grade 2Grade 3

Search terms: Healthy, adult hens will lay an egg daily.Water at the bottom of the incubator creates humidity. This prevents the eggs from drying out.As the heart develops, blood vessels appear.

Grouping Animals [SMART Table activity pack]

These activities encourage students to describe the characteristics of animals verbally and through writing. T...

Subject: Science

Grade: Kindergarten

Publisher: DigiXL

Search terms: liveclassificationdifferenttalentcharacteristicgamesimilarsortinsectwaterfishreptilemammalappearancebaseballgroupbelongclassifyamphibiandifferencefairsizedescribelandcommonsimilarityobservesamebigwritehabitatbehaviorbirdplaysmall

Grouping Animals, HD [SMART Table activity pack]

These activities encourage students to describe the characteristics of animals verbally and through writing. T...

Subject: Science

Grade: Kindergarten

Publisher: DigiXL

Search terms: differencedifferentmammalobservesizesmallfishsortbehaviorfairlandwatergroupsimilaritysameclassifywritehabitatinsectcharacteristicappearancecommonplaydescribeclassificationbigbirdbelongbaseballHDreptiletalentsimilarlivegameamphibian

Counting Terms, HD [SMART Table activity pack]

These activities encourage students to use ordinal terms to count objects, describe a sequence of events and d...

Subject: Mathematics

Grade: Pre-Kindergarten

Publisher: DigiXL

Search terms: firsthappenanimalnumberreelthirdOlympicsdescribeappearancerecipefriendclothingorderfilmcontestfourthcakemedaleventdirectorsecondfifthlinepodiumcompetitionstepbakedancewinphotographmoviesceneHDplacepicturecountordinal term

E1298386.galleryitem [Image]

Subject: Art and DesignHealth and Physical EducationCross-curricular

Grade: Pre-KindergartenGrade 1Grade 2Grade 3Grade 4Grade 5Grade 6Grade 7Grade 8Grade 9Grade 10Grade 11Grade 12Post-Secondary

Publisher: Edupics

Search terms: sport

Terms of Use

© Copyright 2012 SMART Technologies ULC All Rights Reserved | Privacy Policy

Choose your country or region

  1. Canada


  2. United States of America


  3. Additional countries coming soon.

  1. Argentina


  2. Chile


  3. Colombia


  4. República Dominicana


  5. México


  6. Venezuela


  7. Brasil


  8. Peru

    En Desarrollo

  9. Additional countries coming soon.

  1. Belgique


  2. Česká republika


  3. Danmark


  4. Deutschland


  5. Ελλάδα


  6. England


  7. España


  8. France


  9. Ireland


  10. ישראל


  11. Italia


  12. Nederland


  13. Norge


  14. Northern Ireland


  15. Österreich


  16. Россия


  17. Polska


  18. Schweiz | Suisse


  19. Scotland


  20. Suomi


  21. Sverige


  22. Türkiye Cumhuriyeti


  23. Wales


  24. Україна


  25. Additional countries coming soon.

  1. Algérie


  2. مصر


  3. Gabon


  4. Maroc


  5. Nigeria


  6. Sénégal


  7. South Africa


  8. Tunisie


  9. Additional countries coming soon.

  1. العربية السعودية


  2. UAE|دولة الامارات العربية المتحدة


  3. Additional countries coming soon.

  1. Australia


  2. New Zealand


  3. India


  4. 中国


  5. 臺灣


  6. Additional countries coming soon.